Structure of PDB 1nb9 Chain A

Receptor sequence
>1nb9A (length=147) Species: 9606 (Homo sapiens) [Search protein sequence]
RHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWA
SVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIVG
YLRPEKNFDSLESLISAIQGDIEEAKKRLELPEYLKIKEDNFFQVSK
3D structure
PDB1nb9 Crystal Structure of Human Riboflavin Kinase Reveals a Beta Barrel Fold and a Novel Active Site Arch
ChainA
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.1.26: riboflavin kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A G22 G26 S27 K28 P33 T34 N36 I89 F93 D96 F97 Y98 G14 G18 S19 K20 P25 T26 N28 I81 F85 D88 F89 Y90
BS02 RBF A I53 E86 R111 K114 F116 L122 I126 I45 E78 R103 K106 F108 L114 I118
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008531 riboflavin kinase activity
GO:0016301 kinase activity
GO:0046872 metal ion binding
Biological Process
GO:0006771 riboflavin metabolic process
GO:0006915 apoptotic process
GO:0009231 riboflavin biosynthetic process
GO:0009398 FMN biosynthetic process
GO:0016310 phosphorylation
GO:0033864 positive regulation of NAD(P)H oxidase activity
GO:0072388 flavin adenine dinucleotide biosynthetic process
GO:0072593 reactive oxygen species metabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1nb9, PDBe:1nb9, PDBj:1nb9
PDBsum1nb9
PubMed12623014
UniProtQ969G6|RIFK_HUMAN Riboflavin kinase (Gene Name=RFK)

[Back to BioLiP]