Structure of PDB 1na3 Chain A |
>1na3A (length=86) Species: 32644 (unidentified) [Search protein sequence] |
GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYK QGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG |
|
PDB | 1na3 Design of Stable alpha-Helical Arrays from an Idealized TPR Motif |
Chain | A |
Resolution | 1.55 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
IPT |
A |
N46 Y49 K50 N77 |
N46 Y49 K50 N77 |
|
|
|