Structure of PDB 1n8u Chain A

Receptor sequence
>1n8uA (length=100) Species: 55057 (Mamestra brassicae) [Search protein sequence]
KYTDKYDNINLDEILANKRLLVAYVNCVMERGKCSPEGKELKEHLQDAIE
NGCKKCTENQEKGAYRVIEHLIKNEIEIWRELTAKYDPTGNWRKKYEDRA
3D structure
PDB1n8u Moth chemosensory protein exhibits drastic conformational changes and cooperativity on ligand binding.
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BDD A Y8 D9 Y26 V27 Y6 D7 Y24 V25 MOAD: Kd=0.93uM
PDBbind-CN: -logKd/Ki=6.03,Kd=0.93uM
BS02 BDD A E42 L43 A50 W94 Y98 E40 L41 A48 W92 Y96 MOAD: Kd=0.93uM
PDBbind-CN: -logKd/Ki=6.03,Kd=0.93uM
BS03 BDD A I51 D89 I49 D87 MOAD: Kd=0.93uM
PDBbind-CN: -logKd/Ki=6.03,Kd=0.93uM
External links