Structure of PDB 1n89 Chain A

Receptor sequence

>1n89A (length=67) Species: 4567 (Triticum turgidum subsp. durum)

ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRS
PHARDTLTSCGLAVPHC

3D structure

• PDB: 1n89 Refined solution structure of a liganded type 2 wheat nonspecific lipid transfer protein.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PGM	A	L7 F35 Y44 Y47 I48 R54 L57 P65 H66	L7 F35 Y44 Y47 I48 R54 L57 P65 H66

Gene Ontology

Molecular Function

• GO:0008289 lipid binding

Biological Process

• GO:0006869 lipid transport
• GO:0071555 cell wall organization

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1n89, PDBe:1n89, PDBj:1n89
• PDBsum: 1n89
• PubMed: 12525478
• UniProt: P82900|NLT2G_WHEAT Non-specific lipid-transfer protein 2G