Structure of PDB 1n56 Chain A

Receptor sequence

>1n56A (length=341) Species: 2287 (Saccharolobus solfataricus)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 1n56 Snapshots of replication through an abasic lesion; structural basis for base substitutions and frameshifts.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G185 G187 T190 R298 R300 T301	G185 G187 T190 R298 R300 T301
BS02	dna	A	F37 S40 G41 G218 A220 R242 K243 S244 G246 R247 I248 R331 R332 R336	F37 S40 G41 G218 A220 R242 K243 S244 G246 R247 I248 R331 R332 R336
BS03	MG	A	D7 E106	D7 E106
BS04	MG	A	D7 F8 D105	D7 F8 D105
BS05	ATP	A	D7 Y10 F11 Y12 A44 R51 A57 D105 K159	D7 Y10 F11 Y12 A44 R51 A57 D105 K159

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1n56, PDBe:1n56, PDBj:1n56
• PDBsum: 1n56
• PubMed: 15023344
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)