Structure of PDB 1n48 Chain A

Receptor sequence

>1n48A (length=342) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE

3D structure

• PDB: 1n48 Crystal structure of a Y-family DNA polymerase in action: a mechanism for error-prone and lesion-bypass replication.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	D105 E106 K152 G185 G187 I189 T190 K243 R336	D105 E106 K152 G185 G187 I189 T190 K243 R336
BS02	dna	A	S34 R36 S40 G41 A42 A220 K221 R242 R247 K275 L293 R331	S34 R36 S40 G41 A42 A220 K221 R242 R247 K275 L293 R331
BS03	ATP	A	D7 D9 Y10 A44 R51 G58 K159	D7 D9 Y10 A44 R51 G58 K159
BS04	CA	A	D7 D105 E106	D7 D105 E106
BS05	CA	A	D7 F8 D105	D7 F8 D105

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1n48, PDBe:1n48, PDBj:1n48
• PDBsum: 1n48
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)