Structure of PDB 1n07 Chain A

Receptor sequence
>1n07A (length=154) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLR
YRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFY
EEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKD
PFFK
3D structure
PDB1n07 Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
ChainA
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.1.26: riboflavin kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A H32 G33 R36 G37 S38 K39 P44 T45 H98 L99 D106 F107 Y108 H24 G25 R28 G29 S30 K31 P36 T37 H90 L91 D98 F99 Y100
BS02 FMN A G33 F34 R36 V64 V79 S81 E96 R121 E123 L124 Y126 L132 I136 G25 F26 R28 V56 V71 S73 E88 R113 E115 L116 Y118 L124 I128
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0008531 riboflavin kinase activity
GO:0016301 kinase activity
GO:0046872 metal ion binding
Biological Process
GO:0006771 riboflavin metabolic process
GO:0009231 riboflavin biosynthetic process
GO:0009398 FMN biosynthetic process
GO:0016310 phosphorylation
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n07, PDBe:1n07, PDBj:1n07
PDBsum1n07
PubMed12595258
UniProtO74866|RIFK_SCHPO Riboflavin kinase (Gene Name=fmn1)

[Back to BioLiP]