Structure of PDB 1myt Chain A

Receptor sequence

>1mytA (length=146) Species: 8236 (Thunnus albacares)

ADFDAVLKCWGPVEADYTTMGGLVLTRLFKEHPETQKLFPKFAGIAQADI
AGNAAISAHGATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFK
LISEVLVKVMHEKAGLDAGGQTALRNVMGIIIADLEANYKELGFSG

3D structure

• PDB: 1myt 1.70 A resolution structure of myoglobin from yellowfin tuna. An example of a myoglobin lacking the D helix.
• Chain: A
• Resolution: 1.74 Å

Enzymatic activity

• Enzyme Commision number: 1.11.1.-
  1.7.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	L42 F43 K45 H64 L89 S92 H93 H97 I99 N103 F104	L38 F39 K41 H59 L84 S87 H88 H92 I94 N98 F99

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0016491 oxidoreductase activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0098809 nitrite reductase activity

Biological Process

• GO:0015671 oxygen transport
• GO:0019430 removal of superoxide radicals

Cellular Component

• GO:0005737 cytoplasm
• GO:0016528 sarcoplasm
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1myt, PDBe:1myt, PDBj:1myt
• PDBsum: 1myt
• PubMed: 15299440
• UniProt: P02205|MYG_THUAL Myoglobin (Gene Name=mb)