Structure of PDB 1mxi Chain A

Receptor sequence

>1mxiA (length=156) Species: 727 (Haemophilus influenzae)

MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLRRSGLD
YHEFAEIKRHKTFEAFLESEKPKRLFALTTKGCPAHSQVKFKLGDYLMFG
PETRGIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVYEAWRQLGY
KGAVNL

3D structure

• PDB: 1mxi Structure of the YibK methyltransferase from Haemophilus influenzae (HI0766): a Cofactor Bound at a Site Formed by a Knot
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	A	L78 T79 T80 F99 G100 P101 E102 R104 G105 R121 I122 M124 S130 M131 S136	L78 T79 T80 F99 G100 P101 E102 R104 G105 R121 I122 M124 S130 M131 S136

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0008168 methyltransferase activity
• GO:0008173 RNA methyltransferase activity
• GO:0008175 tRNA methyltransferase activity
• GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
• GO:0042802 identical protein binding
• GO:0141098 tRNA (cytidine(34)-2'-O)-methyltransferase activity
• GO:0141102 tRNA (5-carboxymethylaminomethyluridine(34)-2'-O)-methyltransferase activity

Biological Process

• GO:0001510 RNA methylation
• GO:0002131 wobble position cytosine ribose methylation
• GO:0002132 wobble position uridine ribose methylation
• GO:0006396 RNA processing
• GO:0008033 tRNA processing
• GO:0030488 tRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1mxi, PDBe:1mxi, PDBj:1mxi
• PDBsum: 1mxi
• PubMed: 12596263
• UniProt: P44868|TRML_HAEIN tRNA (cytidine(34)-2'-O)-methyltransferase (Gene Name=trmL)