Structure of PDB 1mxe Chain A

Receptor sequence
>1mxeA (length=144) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAA
ELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTS
3D structure
PDB1mxe Structure of the Complex of Calmodulin with the Target Sequence of Calmodulin-Dependent Protein Kinase I: Studies of the Kinase Activation Mechanism
ChainA
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V32
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0016247 channel regulator activity
GO:0030234 enzyme regulator activity
GO:0031489 myosin V binding
GO:0032036 myosin heavy chain binding
GO:0046872 metal ion binding
GO:0070855 myosin VI head/neck binding
Biological Process
GO:0007099 centriole replication
GO:0007605 sensory perception of sound
GO:0007608 sensory perception of smell
GO:0016056 G protein-coupled opsin signaling pathway
GO:0016059 negative regulation of opsin-mediated signaling pathway
GO:0016060 negative regulation of phospholipase C-activating phototransduction signaling pathway
GO:0030048 actin filament-based movement
GO:0042052 rhabdomere development
GO:0046716 muscle cell cellular homeostasis
GO:0048102 autophagic cell death
GO:0050911 detection of chemical stimulus involved in sensory perception of smell
GO:0051383 kinetochore organization
GO:0071361 cellular response to ethanol
GO:0072499 photoreceptor cell axon guidance
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005814 centriole
GO:0005819 spindle
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005938 cell cortex
GO:0016028 rhabdomere
GO:0030496 midbody
GO:0031475 myosin V complex
GO:0031476 myosin VI complex
GO:0031477 myosin VII complex
GO:0072686 mitotic spindle
GO:0097431 mitotic spindle pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mxe, PDBe:1mxe, PDBj:1mxe
PDBsum1mxe
PubMed12475216
UniProtP62152|CALM_DROME Calmodulin (Gene Name=Cam)

[Back to BioLiP]