Structure of PDB 1mwz Chain A |
>1mwzA (length=73) Species: 562 (Escherichia coli) [Search protein sequence] |
SGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADND IRAQVESALQKAGYSLRDEQAAE |
|
PDB | 1mwz A new zinc-protein coordination site in intracellular metal trafficking: solution structure of the apo and Zn(II) forms of ZntA (46-118) |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D14 C15 |
D13 C14 |
|
|
|
|