Structure of PDB 1mvo Chain A |
>1mvoA (length=121) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLI VLDVMLPKLDGIEVCKQLRQQKLMFPILMLTAKDEEFDKVLGLELGADDY MTKPFSPREVNARVKAILRRS |
|
PDB | 1mvo The Crystal Structure of the Phosphorylation Domain in PhoP Reveals a Functional Tandem Association Mediated by an Asymmetric Interface |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
D10 D53 M55 |
D10 D53 M55 |
|
|
|
|