Structure of PDB 1mt1 Chain A

Receptor sequence
>1mt1A (length=46) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRIS
3D structure
PDB1mt1 Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii: Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N47 S52
Catalytic site (residue number reindexed from 1) N41 S46
Enzyme Commision number 4.1.1.19: arginine decarboxylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AG2 A L31 D35 L38 L25 D29 L32
Gene Ontology
Molecular Function
GO:0008792 arginine decarboxylase activity
GO:0016831 carboxy-lyase activity
Biological Process
GO:0006520 amino acid metabolic process
GO:0006527 arginine catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1mt1, PDBe:1mt1, PDBj:1mt1
PDBsum1mt1
PubMed12623016
UniProtQ57764|PDAD_METJA Pyruvoyl-dependent arginine decarboxylase (Gene Name=pdaD)

[Back to BioLiP]