Structure of PDB 1mnc Chain A

Receptor sequence
>1mncA (length=158) Species: 9606 (Homo sapiens) [Search protein sequence]
GPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTGISQG
EADINIAFYQRDHGDGSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTN
TSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDI
DGIQAIYG
3D structure
PDB1mnc Structure of human neutrophil collagenase reveals large S1' specificity pocket.
ChainA
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H218 E219 H222 H228
Catalytic site (residue number reindexed from 1) H113 E114 H117 H123
Enzyme Commision number 3.4.24.34: neutrophil collagenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H218 H222 H228 H113 H117 H123
BS02 ZN A H168 D170 H183 H196 H63 D65 H78 H91
BS03 CA A D175 G176 N178 I180 D198 E201 D70 G71 N73 I75 D93 E96
BS04 PLH A G179 I180 L181 A182 H218 E219 H222 H228 P238 N239 Y240 G74 I75 L76 A77 H113 E114 H117 H123 P133 N134 Y135 PDBbind-CN: -logKd/Ki=10.34,IC50=0.046nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mnc, PDBe:1mnc, PDBj:1mnc
PDBsum1mnc
PubMed7656015
UniProtP22894|MMP8_HUMAN Neutrophil collagenase (Gene Name=MMP8)

[Back to BioLiP]