Structure of PDB 1mms Chain A

Receptor sequence
>1mmsA (length=133) Species: 2336 (Thermotoga maritima) [Search protein sequence]
QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVV
ITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEE
IAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVV
3D structure
PDB1mms A detailed view of a ribosomal active site: the structure of the L11-RNA complex.
ChainA
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A K10 P74 A75 S76 K80 K87 G88 S89 S90 E91 P92 K93 R94 K112 D115 N117 A118 N119 A123 K126 I127 G130 T131 K133 S134 M135 K3 P67 A68 S69 K73 K80 G81 S82 S83 E84 P85 K86 R87 K105 D108 N110 A111 N112 A116 K119 I120 G123 T124 K126 S127 M128
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mms, PDBe:1mms, PDBj:1mms
PDBsum1mms
PubMed10338213
UniProtP29395|RL11_THEMA Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]