Structure of PDB 1mmb Chain A

Receptor sequence

>1mmbA (length=158) Species: 9606 (Homo sapiens)

NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQG
EADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTN
TSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDI
DGIQAIYG

3D structure

• PDB: 1mmb Structure determination and analysis of human neutrophil collagenase complexed with a hydroxamate inhibitor.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H197 E198 H201 H207
• Catalytic site (residue number reindexed from 1): H113 E114 H117 H123
• Enzyme Commision number: 3.4.24.34: neutrophil collagenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D137 G169 G171 D173	D53 G85 G87 D89
BS02	CA	A	D154 G155 N157 I159 D177 E180	D70 G71 N73 I75 D93 E96
BS03	ZN	A	H147 D149 H162 H175	H63 D65 H78 H91
BS04	ZN	A	H197 H201 H207	H113 H117 H123
BS05	BAT	A	G158 I159 L160 A161 Y189 H197 E198 H201 H207 P217 N218 Y219	G74 I75 L76 A77 Y105 H113 E114 H117 H123 P133 N134 Y135

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:1mmb, PDBe:1mmb, PDBj:1mmb
• PDBsum: 1mmb
• PubMed: 7577999
• UniProt: P22894|MMP8_HUMAN Neutrophil collagenase (Gene Name=MMP8)