Structure of PDB 1mji Chain A

Receptor sequence
>1mjiA (length=180) Species: 274 (Thermus thermophilus) [Search protein sequence]
LDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARI
LEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIF
LEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDAL
RGMDIAVVTTAETDEEARALLELLGFPFRK
3D structure
PDB1mji Detailed analysis of RNA-protein interactions within the bacterial ribosomal protein L5/5S rRNA complex
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A K36 V38 N40 K74 S124 D126 R128 N132 R153 D156 A158 K34 V36 N38 K72 S122 D124 R126 N130 R151 D154 A156
BS02 rna A Q66 K67 A69 V70 T71 R72 R91 V92 T93 R95 R96 R98 Q64 K65 A67 V68 T69 R70 R89 V90 T91 R93 R94 R96
BS03 MG A R128 G129 N130 T161 R126 G127 N128 T159
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mji, PDBe:1mji, PDBj:1mji
PDBsum1mji
PubMed12515387
UniProtP41201|RL5_THETH Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]