Structure of PDB 1mih Chain A

Receptor sequence

>1mihA (length=128) Species: 562 (Escherichia coli) [Search protein sequence]

ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY
GFVISDWRMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQA
GASGYVVKPFTAATLEEKLNKIFEKLGM

3D structure

PDB

1mih CheZ-mediated dephosphorylation of the Escherichia coli chemotaxis response regulator CheY: role for CheY glutamate 89.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D13 F14 D57 R59	D12 F13 D56 R58
BS02	BEF	A	D57 W58 R59 T87 K109	D56 W57 R58 T86 K108

Gene Ontology

	Molecular Function
GO:0000156	phosphorelay response regulator activity
GO:0000287	magnesium ion binding
GO:0005515	protein binding
GO:0016407	acetyltransferase activity
GO:0046872	metal ion binding

	Biological Process
GO:0000160	phosphorelay signal transduction system
GO:0006935	chemotaxis
GO:0007165	signal transduction
GO:0009454	aerotaxis
GO:0018393	internal peptidyl-lysine acetylation
GO:0043052	thermotaxis
GO:0050920	regulation of chemotaxis
GO:0071977	bacterial-type flagellum-dependent swimming motility
GO:0097588	archaeal or bacterial-type flagellum-dependent cell motility
GO:1902021	regulation of bacterial-type flagellum-dependent cell motility

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0009288	bacterial-type flagellum
GO:0009433	bacterial-type flagellum basal body, C ring
GO:0120107	bacterial-type flagellum rotor complex

External links

PDB	RCSB:1mih, PDBe:1mih, PDBj:1mih
PDBsum	1mih
PubMed	12591865
UniProt	P0AE67\|CHEY_ECOLI Chemotaxis protein CheY (Gene Name=cheY)