Structure of PDB 1mht Chain A

Receptor sequence

>1mhtA (length=327) Species: 726 (Haemophilus haemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 1mht HhaI methyltransferase flips its target base out of the DNA helix.
• Chain: A
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C81 E119 R163 R165
• Catalytic site (residue number reindexed from 1): C81 E119 R163 R165
• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y44 I86 Q90 K234 G236 Q237 G256 G257 I258 S294 Q297	Y44 I86 Q90 K234 G236 Q237 G256 G257 I258 S294 Q297
BS02	dna	A	F79 P80 C81 S85 I86 S87 R97 E119 V121 K162 R165 T226 R228 Q237 R240 Y242 T250 A253 Y254 G256 N304	F79 P80 C81 S85 I86 S87 R97 E119 V121 K162 R165 T226 R228 Q237 R240 Y242 T250 A253 Y254 G256 N304
BS03	SAH	A	F18 A19 L21 G23 E40 W41 D60 I61 N304 S305	F18 A19 L21 G23 E40 W41 D60 I61 N304 S305

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:1mht, PDBe:1mht, PDBj:1mht
• PDBsum: 1mht
• PubMed: 8293469
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)