Structure of PDB 1mdv Chain A

Receptor sequence

>1mdvA (length=101) Species: 882 (Nitratidesulfovibrio vulgaris str. Hildenborough)

DGLKMEATKQPVVLNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMD
KKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCH
E

3D structure

• PDB: 1mdv Key role of phenylalanine 20 in cytochrome c3: structure, stability, and function studies.
• Chain: A
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M11 L20 H22 V28 C30 C33 H34 Y43 K45	M5 L14 H16 V22 C24 C27 H28 Y37 K39
BS02	HEM	A	H35 C46 C51 H52 H67 T74 K75	H29 C40 C45 H46 H61 T68 K69
BS03	HEM	A	L20 H25 C79 C82 H83 K104	L14 H19 C73 C76 H77 K98
BS04	HEM	A	M11 V18 Y65 H70 C79 H83 C100 C105 H106	M5 V12 Y59 H64 C73 H77 C94 C99 H100
BS05	HEM	A	Q16 P17	Q10 P11

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1mdv, PDBe:1mdv, PDBj:1mdv
• PDBsum: 1mdv
• PubMed: 9890880
• UniProt: P00131|CYC3_NITV2 Cytochrome c3 (Gene Name=DVU_3171)