Structure of PDB 1mdi Chain A

Receptor sequence
>1mdiA (length=105) Species: 9606 (Homo sapiens) [Search protein sequence]
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYS
NVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEAT
INELV
3D structure
PDB1mdi Solution structure of human thioredoxin in a mixed disulfide intermediate complex with its target peptide from the transcription factor NF kappa B.
ChainA
ResolutionN/A
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C32 G33 P34 A35
Catalytic site (residue number reindexed from 1) C32 G33 P34 A35
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A W31 C32 P34 V59 D60 D61 Q63 V71 K72 A73 T74 S90 G91 A92 W31 C32 P34 V59 D60 D61 Q63 V71 K72 A73 T74 S90 G91 A92
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
GO:0005515 protein binding
GO:0015035 protein-disulfide reductase activity
GO:0042803 protein homodimerization activity
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0009314 response to radiation
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0043388 positive regulation of DNA binding
GO:0045454 cell redox homeostasis
GO:0046826 negative regulation of protein export from nucleus
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0061692 cellular detoxification of hydrogen peroxide
GO:0071731 response to nitric oxide
GO:2000170 positive regulation of peptidyl-cysteine S-nitrosylation
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mdi, PDBe:1mdi, PDBj:1mdi
PDBsum1mdi
PubMed7788295
UniProtP10599|THIO_HUMAN Thioredoxin (Gene Name=TXN)

[Back to BioLiP]