Structure of PDB 1mcx Chain A

Receptor sequence
>1mcxA (length=304) Species: 9823 (Sus scrofa) [Search protein sequence]
TFNPSSDVEALHKAITVKGVDEATIIEILTKRTNAQRQQIKAAYLQEKGK
PLDEALKKALTGHLEEVALALLKTPAQFDADELRAAMKGLGTDEDTLNEI
LASRTNREIREINRVYKEELKRDLAKDITSDTSGDYQKALLSLAKGDRSE
DLAINDDLADTDARALYEAGERRKGTDLNVFITILTTRSYPHLRRVFQKY
SKYSKHDMNKVLDLELKGDIENCLTVVVKCATSKPMFFAEKLHQAMKGIG
TRHKTLIRIMVSRSEIDMNDIKACYQKLYGISLCQAILDETKGDYEKILV
ALCG
3D structure
PDB1mcx A Calcium-driven Conformational Switch of the N-terminaland Core Domains of Annexin A1
ChainA
Resolution2.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A G59 V60 E62 G19 V20 E22
BS02 CA A K97 L100 E105 K57 L60 E65
BS03 CA A M127 G129 G131 D171 M87 G89 G91 D131
BS04 CA A T132 E134 T92 E94
BS05 CA A G210 R213 G215 E255 G170 R173 G175 E215
BS06 CA A M286 G288 G290 E330 M246 G248 G250 E290
BS07 CA A L328 T331 K332 E336 L288 T291 K292 E296
BS08 CA A D253 L256 E261 D213 L216 E221
Gene Ontology
Molecular Function
GO:0001786 phosphatidylserine binding
GO:0004859 phospholipase inhibitor activity
GO:0005509 calcium ion binding
GO:0005544 calcium-dependent phospholipid binding
GO:0019834 phospholipase A2 inhibitor activity
GO:0046872 metal ion binding
Biological Process
GO:0002250 adaptive immune response
GO:0002548 monocyte chemotaxis
GO:0002685 regulation of leukocyte migration
GO:0006909 phagocytosis
GO:0006954 inflammatory response
GO:0007165 signal transduction
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0008360 regulation of cell shape
GO:0030036 actin cytoskeleton organization
GO:0032652 regulation of interleukin-1 production
GO:0032743 positive regulation of interleukin-2 production
GO:0042102 positive regulation of T cell proliferation
GO:0042119 neutrophil activation
GO:0045087 innate immune response
GO:0045627 positive regulation of T-helper 1 cell differentiation
GO:0045629 negative regulation of T-helper 2 cell differentiation
GO:0045920 negative regulation of exocytosis
GO:0046883 regulation of hormone secretion
GO:0050727 regulation of inflammatory response
GO:0071385 cellular response to glucocorticoid stimulus
GO:0071621 granulocyte chemotaxis
GO:0090303 positive regulation of wound healing
Cellular Component
GO:0001891 phagocytic cup
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0012506 vesicle membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0016328 lateral plasma membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031514 motile cilium
GO:0031901 early endosome membrane
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mcx, PDBe:1mcx, PDBj:1mcx
PDBsum1mcx
PubMed12595246
UniProtP19619|ANXA1_PIG Annexin A1 (Gene Name=ANXA1)

[Back to BioLiP]