Structure of PDB 1mb3 Chain A |
>1mb3A (length=117) Species: 155892 (Caulobacter vibrioides) [Search protein sequence] |
TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLIL MDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTDEERIREGGCEAYISKPI SVVHFLETIKRLLERQP |
|
PDB | 1mb3 Crystallographic and Biochemical Studies of DivK Reveal Novel Features of an Essential Response Regulator in Caulobacter crescentus. |
Chain | A |
Resolution | 1.41 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
E9 D10 D53 |
E8 D9 D52 |
|
|
|
|