Structure of PDB 1m7g Chain A

Receptor sequence

>1m7gA (length=208) Species: 5076 (Penicillium chrysogenum)

STNITFHASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVR
DRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIA
ITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRDPK
GLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLD
TKGYLPAK

3D structure

• PDB: 1m7g Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
• Chain: A
• Resolution: 1.43 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.25: adenylyl-sulfate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	A	T13 R14 R17	T12 R13 R16
BS02	SO4	A	R14 R17 R21 K203	R13 R16 R20 K202
BS03	SO4	A	R110 R113 E135 P175 A176	R109 R112 E134 P174 A175
BS04	AV2	A	A35 S36 G37 K38 S39 T40 R148 N184 L187 V189	A34 S35 G36 K37 S38 T39 R147 N183 L186 V188
BS05	ADX	A	S34 R66 F75 R80 N83 F105 I106 S107 L153 E164 F165 T166	S33 R65 F74 R79 N82 F104 I105 S106 L152 E163 F164 T165

Gene Ontology

Molecular Function

• GO:0004020 adenylylsulfate kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity

Biological Process

• GO:0000103 sulfate assimilation
• GO:0009086 methionine biosynthetic process
• GO:0016310 phosphorylation
• GO:0019344 cysteine biosynthetic process
• GO:0070814 hydrogen sulfide biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1m7g, PDBe:1m7g, PDBj:1m7g
• PDBsum: 1m7g
• PubMed: 12427029
• UniProt: Q12657|KAPS_PENCH Adenylyl-sulfate kinase