Structure of PDB 1m56 Chain A

Receptor sequence

>1m56A (length=547) Species: 1063 (Cereibacter sphaeroides)

RGFFTRWFMSTNHKDIGVLYLFTGGLVGLISVAFTVYMRMELMAPGVQFM
CAEHLESGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGILMMFFVVIP
ALFGGFGNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGN
GQLGSGIGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFL
NMRAPGMTMHKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTF
FQPSGGGDPVLYQHILWFFGHPEVYIIVLPAFGIVSHVIATFAKKPIFGY
LPMVYAMVAIGVLGFVVWAHHMYTAGLSLTQQSYFMMATMVIAVPTGIKI
FSWIATMWGGSIELKTPMLWALGFLFLFTVGGVTGIVLSQASVDRYYHDT
YYVVAHFHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFWMMFVG
ANLTFFPQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLG
VIFYTLTRGARVTANNYWNEHADTLEWTLTSPPPEHTFEQLPKREDW

3D structure

• PDB: 1m56 The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y33 I43 F47 M51 I99 H102 N121 D132 N139 S142 Y146 W172 S200 S201 G204 T211 H284 E286 Y288 S299 P315 H333 H334 T359 K362 H419 F420 H421 R481
• Catalytic site (residue number reindexed from 1): Y20 I30 F34 M38 I86 H89 N108 D119 N126 S129 Y133 W159 S187 S188 G191 T198 H271 E273 Y275 S286 P302 H320 H321 T346 K349 H406 F407 H408 R468
• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	A	H284 H333 H334	H271 H320 H321
BS02	MG	A	H411 D412	H398 D399
BS03	CA	A	E54 A57 P58 G59 Q61	E41 A44 P45 G46 Q48
BS04	HEA	A	G38 M51 R52 I99 H102 M106 M107 W172 Y414 F420 H421 M424 S425 V429 F468 R481 R482 S504 F508	G25 M38 R39 I86 H89 M93 M94 W159 Y401 F407 H408 M411 S412 V416 F455 R468 R469 S491 F495
BS05	HEA	A	W280 V287 Y288 H333 H334 A356 T359 G360 G395 G398 L401 S402 D407 H411 H419 F420 V423 M424 R481	W267 V274 Y275 H320 H321 A343 T346 G347 G382 G385 L388 S389 D394 H398 H406 F407 V410 M411 R468

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0005515 protein binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0009060 aerobic respiration
• GO:0015990 electron transport coupled proton transport
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:1m56, PDBe:1m56, PDBj:1m56
• PDBsum: 1m56
• PubMed: 12144789
• UniProt: P33517|COX1_CERSP Cytochrome c oxidase subunit 1 (Gene Name=ctaD)