Structure of PDB 1m45 Chain A

Receptor sequence
>1m45A (length=142) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TRANKDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIINASLAS
SLTLDQITGLIEVNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLR
YMLTGLGEKLTDAEVDELLKGVEVDSNGEIDYKKFIEDVLRQ
3D structure
PDB1m45 Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
ChainA
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A D29 R32 A33 N37 T39 A81 F86 F90 L110 L113 G114 E115 L117 E124 L125 D145 V146 L147 D26 R29 A30 N34 T36 A74 F79 F83 L103 L106 G107 E108 L110 E117 L118 D138 V139 L140
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0031489 myosin V binding
GO:0032038 myosin II heavy chain binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000920 septum digestion after cytokinesis
GO:0006903 vesicle targeting
GO:0030050 vesicle transport along actin filament
GO:0031991 regulation of actomyosin contractile ring contraction
GO:0032465 regulation of cytokinesis
GO:0051301 cell division
GO:1903338 regulation of cell wall organization or biogenesis
GO:1903475 mitotic actomyosin contractile ring assembly
GO:1903476 protein localization to cell division site involved in mitotic actomyosin contractile ring assembly
Cellular Component
GO:0000142 cellular bud neck contractile ring
GO:0005886 plasma membrane
GO:0005934 cellular bud tip
GO:0005935 cellular bud neck
GO:0016459 myosin complex
GO:0016460 myosin II complex
GO:0030427 site of polarized growth
GO:0031475 myosin V complex
GO:0031982 vesicle
GO:0120155 MIH complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m45, PDBe:1m45, PDBj:1m45
PDBsum1m45
PubMed12554638
UniProtP53141|MLC1_YEAST Myosin light chain 1 (Gene Name=MLC1)

[Back to BioLiP]