Structure of PDB 1m1r Chain A

Receptor sequence

>1m1rA (length=91) Species: 70863 (Shewanella oneidensis) [Search protein sequence]

ADQKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHK
PHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK

3D structure

PDB

1m1r Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c

Chain

Resolution

1.02 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	H9 C15 C18 H19 P24 S25 G28 E31 V64 H65	H9 C15 C18 H19 P24 S25 G28 E31 V64 H65
BS02	HEC	A	P51 H52 L56 C75 C78 H79 R83	P51 H52 L56 C75 C78 H79 R83
BS03	HEC	A	L5 F8 H9 S17 Q34 C35 C38 H39 H62 K72	L5 F8 H9 S17 Q34 C35 C38 H39 H62 K72
BS04	HEC	A	H39 L42 D46 V48 H49 H52 C58 C61 H62 K72 P73	H39 L42 D46 V48 H49 H52 C58 C61 H62 K72 P73

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

External links