Structure of PDB 1m1q Chain A

Receptor sequence

>1m1qA (length=90) Species: 211586 (Shewanella oneidensis MR-1) [Search protein sequence]

DQKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKP
HDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK

3D structure

PDB

1m1q Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c

Chain

Resolution

0.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	H9 C15 C18 H19 P24 S25 G28 E31 V64 H65	H8 C14 C17 H18 P23 S24 G27 E30 V63 H64
BS02	HEC	A	P51 H52 N55 L56 C75 C78 H79 R83 T84	P50 H51 N54 L55 C74 C77 H78 R82 T83
BS03	HEC	A	L5 H9 S17 Q34 C35 C38 H39 H62	L4 H8 S16 Q33 C34 C37 H38 H61
BS04	HEC	A	H39 L42 D46 H49 H52 C58 C61 H62 P73	H38 L41 D45 H48 H51 C57 C60 H61 P72

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

External links