Structure of PDB 1m1p Chain A

Receptor sequence

>1m1pA (length=87) Species: 70863 (Shewanella oneidensis) [Search protein sequence]

QKLSDFHAESGGCESCHKDGTPSADGAFEFAQCQSCHGKLSEMDAVHKPH
DGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVL

3D structure

PDB

1m1p Crystal structures at atomic resolution reveal the novel concept of 'electron-harvesting' as a role for the small tetraheme cytochrome c

Chain

Resolution

1.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	H9 C15 C18 H19 P24 A63 V64 H65	H7 C13 C16 H17 P22 A61 V62 H63
BS02	HEC	A	P51 H52 N55 L56 C75 C78 H79 R83	P49 H50 N53 L54 C73 C76 H77 R81
BS03	HEC	A	L5 H9 C18 Q34 C35 C38 H39 H62	L3 H7 C16 Q32 C33 C36 H37 H60
BS04	HEC	A	H39 L42 D46 V48 H49 H52 C58 C61 H62 P73	H37 L40 D44 V46 H47 H50 C56 C59 H60 P71

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

	Cellular Component
GO:0042597	periplasmic space

External links