Structure of PDB 1m1a Chain A

Receptor sequence
>1m1aA (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB1m1a Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
ChainA
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R440 Y441 R442 P443 T445 R463 R472 R483 F484 Q485 R516 V517 T518 R4 Y5 R6 P7 T9 R27 R36 R47 F48 Q49 R80 V81 T82 PDBbind-CN: Kd=0.6uM
BS02 dna A H439 R440 Y441 G444 T445 V446 A447 R449 R463 K464 L465 R469 R483 H3 R4 Y5 G8 T9 V10 A11 R13 R27 K28 L29 R33 R47 PDBbind-CN: Kd=0.6uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m1a, PDBe:1m1a, PDBj:1m1a
PDBsum1m1a
PubMed12559907
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]