Structure of PDB 1m18 Chain A

Receptor sequence
>1m18A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB1m18 Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
ChainA
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R442 T445 R463 R472 R483 F484 Q485 R516 V517 T518 R5 T8 R26 R35 R46 F47 Q48 R79 V80 T81 PDBbind-CN: Kd=0.6uM
BS02 dna A R440 Y441 G444 V446 A447 R449 R463 K464 L465 P466 R469 R483 R3 Y4 G7 V9 A10 R12 R26 K27 L28 P29 R32 R46 PDBbind-CN: Kd=0.6uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m18, PDBe:1m18, PDBj:1m18
PDBsum1m18
PubMed12559907
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]