Structure of PDB 1m07 Chain A

Receptor sequence
>1m07A (length=111) Species: 8400 (Aquarana catesbeiana) [Search protein sequence]
QNWATFQQKHIINTPIINCNTIMDNNIYIVGGQCKRVNTFIISSATTVKA
ICTGVINMNVLSTTRFQLNTCTRTSITPRPCPYSSRTETNYICVKCENQY
PVHFAGIGRCP
3D structure
PDB1m07 Residues involved in the catalysis, base specificity, and cytotoxicity of ribonuclease from Rana catesbeiana based upon mutagenesis and X-ray crystallography
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.27.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A E1 K9 H10 K35 V37 N38 T39 K95 E97 V102 H103 F104 E1 K9 H10 K35 V37 N38 T39 K95 E97 V102 H103 F104
BS02 dna A I56 N57 K95 E97 I56 N57 K95 E97
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0004540 RNA nuclease activity
GO:0030246 carbohydrate binding
Biological Process
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1m07, PDBe:1m07, PDBj:1m07
PDBsum1m07
PubMed12499382
UniProtP11916|RNASO_AQUCT Oocytes ribonuclease (Gene Name=RCR)

[Back to BioLiP]