Structure of PDB 1lxg Chain A |
>1lxgA (length=71) Species: 8649 (Naja kaouthia) [Search protein sequence] |
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKT GVDIQCCSTDNCNPFPTRKRP |
|
PDB | 1lxg NMR-based Binding Screen and Structural Analysis of the Complex Formed between alpha-Cobratoxin and an 18-mer Cognate Peptide Derived from the alpha1 Subunit of the Nicotinic Acetylcholine Receptor from Torpedo californica |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
|