Structure of PDB 1ls9 Chain A

Receptor sequence

>1ls9A (length=91) Species: 162068 (Cladophora glomerata)

VDAELLADGKKVFAGNCAACHLGGNNSVLADKTLKKDAIEKYLEGGLTLE
AIKYQVNNGKGAMPAWADRLDEDDIEAVSNYVYDQAVNSKW

3D structure

• PDB: 1ls9 Structural Basis for the Molecular Properties of Cytochrome C(6)
• Chain: A
• Resolution: 1.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	C17 C20 H21 N26 V28 K32 T33 L34 Q55 K60 A62 M63 P64 W66	C17 C20 H21 N26 V28 K32 T33 L34 Q55 K60 A62 M63 P64 W66

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009543 chloroplast thylakoid lumen
• GO:0009579 thylakoid

External links

• PDB: RCSB:1ls9, PDBe:1ls9, PDBj:1ls9
• PDBsum: 1ls9
• PubMed: 12475218
• UniProt: P83391|CYC6_CLAGO Cytochrome c6 (Gene Name=petJ)