Structure of PDB 1lom Chain A |
>1lomA (length=101) Species: 45916 (Nostoc ellipsosporum) [Search protein sequence] |
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQ SPNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKY E |
|
PDB | 1lom Domain-swapped structure of a mutant of cyanovirin-N. |
Chain | A |
Resolution | 1.72 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
A71 S82 T83 |
A71 S82 T83 |
|
|
|
|