Structure of PDB 1lo1 Chain A

Receptor sequence
>1lo1A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
AIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECE
ITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYK
3D structure
PDB1lo1 Monomeric Complex of Human Orphan Estrogen Related Receptor-2 with DNA: A Pseudo-dimer Interface Mediates Extended Half-site Recognition
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R101 Y113 H114 Y115 K124 K128 Q132 R174 R177 V178 R179 G180 R182 Q183 K184 R5 Y17 H18 Y19 K28 K32 Q36 R78 R81 V82 R83 G84 R86 Q87 K88 PDBbind-CN: Kd=7.1nM
BS02 dna A E121 R129 R152 K153 Q156 R159 R179 G180 G181 R182 E25 R33 R56 K57 Q60 R63 R83 G84 G85 R86 PDBbind-CN: Kd=7.1nM
BS03 ZN A C103 C123 C7 C27
BS04 ZN A C139 C145 C155 C43 C49 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1lo1, PDBe:1lo1, PDBj:1lo1
PDBsum1lo1
PubMed12654265
UniProtO95718|ERR2_HUMAN Steroid hormone receptor ERR2 (Gene Name=ESRRB)

[Back to BioLiP]