Structure of PDB 1lms Chain A

Receptor sequence

>1lmsA (length=95) Species: 4932 (Saccharomyces cerevisiae)

LFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVL
WDENNMSEYLTNPAKYIPGTAMAFGGLKKEKDRNDLITYLKKATE

3D structure

• PDB: 1lms Structural model for an alkaline form of ferricytochrome c
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C14 C17 H18 G29 L32 G41 Y48 N52 W59 K73	C6 C9 H10 G21 L24 G33 Y40 N44 W51 K65

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:1lms, PDBe:1lms, PDBj:1lms
• PDBsum: 1lms
• PubMed: 12617658
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)