Structure of PDB 1lmc Chain A

Receptor sequence
>1lmcA (length=129) Species: 8022 (Oncorhynchus mykiss) [Search protein sequence]
KVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNTDGS
TDYGIFQINSRYWCDDGRTPGAKNVCGIRCSQLLTDDLTVAIRCAKRVVL
DPNGIGAWVAWRLHCQNQDLRSYVAGCGV
3D structure
PDB1lmc Structure of a complex between bulgecin, a bacterial metabolite, and lysozyme from the rainbow trout.
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E35 N46 D48 S50 D52 N59
Catalytic site (residue number reindexed from 1) E35 N46 D48 S50 D52 N59
Enzyme Commision number 3.2.1.17: lysozyme.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BUL A E35 N46 T47 D52 Q57 I58 N59 Y62 W63 A107 W108 V109 E35 N46 T47 D52 Q57 I58 N59 Y62 W63 A107 W108 V109
Gene Ontology
Molecular Function
GO:0003796 lysozyme activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
Biological Process
GO:0031640 killing of cells of another organism
GO:0042742 defense response to bacterium
GO:0050829 defense response to Gram-negative bacterium
GO:0050830 defense response to Gram-positive bacterium
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1lmc, PDBe:1lmc, PDBj:1lmc
PDBsum1lmc
PubMed15299732
UniProtP11941|LYSC2_ONCMY Lysozyme C II

[Back to BioLiP]