Structure of PDB 1le8 Chain A

Receptor sequence
>1le8A (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRM
RSK
3D structure
PDB1le8 Structural and Thermodynamic Characterization of the DNA Binding Properties of a Triple Alanine Mutant of MATalpha2
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K100 R115 I119 R122 M123 K27 R42 I46 R49 M50 PDBbind-CN: Kd=4.51uM
BS02 dna A R82 Q113 V116 N120 R124 R9 Q40 V43 N47 R51 PDBbind-CN: Kd=4.51uM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1le8, PDBe:1le8, PDBj:1le8
PDBsum1le8
PubMed12121651
UniProtP0CY10|MATA1_YEASX Mating-type protein A1 (Gene Name=MATA1)

[Back to BioLiP]