Structure of PDB 1ldq Chain A

Receptor sequence

>1ldqA (length=111) Species: 9031 (Gallus gallus)

CSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAIKESPLHGTENTINKRT
QPTFGFTVNWKFSESTTVFTGQCFIDGKEVLKTMWLLRSSVNDIGDDWKA
TRVGINIFTRL

3D structure

• PDB: 1ldq Ligand exchange between proteins: exchange of biotin and biotin derivatives between avidin and streptavidin
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SHM	A	W70 T77 W97	W60 T67 W85

Gene Ontology

Molecular Function

• GO:0009374 biotin binding

Biological Process

• GO:0019731 antibacterial humoral response

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1ldq, PDBe:1ldq, PDBj:1ldq
• PDBsum: 1ldq
• PubMed: 12055191
• UniProt: P02701|AVID_CHICK Avidin (Gene Name=AVD)