Structure of PDB 1lbf Chain A

Receptor sequence

>1lbfA (length=247) Species: 2287 (Saccharolobus solfataricus)

PRYLKGWLKDVVQLSLRRPSFRASRQRPIISLNERILEFNKRNITAIIAE
YKRKSPSGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGSYETLRKIAS
SVSIPILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARS
YGMEPLIEINDENDLDIALRIGARFIGINSRDLETLEINKENQRKLISMI
PSNVVKVAESGISERNEIEELRKLGVNAFLIGSSLMRNPEKIKEFIL

3D structure

• PDB: 1lbf The catalytic mechanism of indole-3-glycerol phosphate synthase: crystal structures of complexes of the enzyme from Sulfolobus solfataricus with substrate analogue, substrate, and product.
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E51 K53 K110 E159 N180 E210 S211
• Catalytic site (residue number reindexed from 1): E50 K52 K109 E158 N179 E209 S210
• Enzyme Commision number: 4.1.1.48: indole-3-glycerol-phosphate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	137	A	W8 E51 K53 S56 P57 S58 F89 K110 R182 L184 L187 S211 G212 L231 G233 S234	W7 E50 K52 S55 P56 S57 F88 K109 R181 L183 L186 S210 G211 L230 G232 S233	MOAD: Kd=0.014uM PDBbind-CN: -logKd/Ki=7.85,Kd=0.014uM

Gene Ontology

Molecular Function

• GO:0004425 indole-3-glycerol-phosphate synthase activity
• GO:0004640 phosphoribosylanthranilate isomerase activity
• GO:0016830 carbon-carbon lyase activity
• GO:0016831 carboxy-lyase activity

Biological Process

• GO:0000162 tryptophan biosynthetic process
• GO:0006568 tryptophan metabolic process

External links

• PDB: RCSB:1lbf, PDBe:1lbf, PDBj:1lbf
• PDBsum: 1lbf
• PubMed: 12054868
• UniProt: Q06121|TRPC_SACS2 Indole-3-glycerol phosphate synthase (Gene Name=trpC)