Structure of PDB 1lba Chain A

Receptor sequence
>1lbaA (length=146) Species: 10760 (Escherichia phage T7) [Search protein sequence]
AKQRESTDAIFVHCSATKPSQNVGVREIRQWHKEQGWLDVGYHFIIKRDG
TVEAGRDEMAVGSHAKGYNHNSIGVCLVGGIDDKGKFDANFTPAQMQSLR
SLLVTLLAKYEGAVLRAHHEVAPKACPSFDLKRWWEKNELVTSDRG
3D structure
PDB1lba The structure of bacteriophage T7 lysozyme, a zinc amidase and an inhibitor of T7 RNA polymerase.
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H17 Y46 H122 K128 C130
Catalytic site (residue number reindexed from 1) H13 Y42 H118 K124 C126
Enzyme Commision number 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H17 H122 C130 H13 H118 C126
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0009253 peptidoglycan catabolic process
GO:0031640 killing of cells of another organism
GO:0032897 negative regulation of viral transcription
GO:0042742 defense response to bacterium
GO:0044659 viral release from host cell by cytolysis
Cellular Component
GO:0030430 host cell cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1lba, PDBe:1lba, PDBj:1lba
PDBsum1lba
PubMed8171031
UniProtP00806|ENLYS_BPT7 Endolysin (Gene Name=3.5)

[Back to BioLiP]