Structure of PDB 1lb3 Chain A

Receptor sequence
>1lb3A (length=167) Species: 10090 (Mus musculus) [Search protein sequence]
SQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFF
RELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALA
MEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNL
RRVASLGEYLFERLTLK
3D structure
PDB1lb3 Structural description of the active sites of mouse L-chain ferritin at 1.2A resolution
ChainA
Resolution1.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CD A E60 E64 E55 E59
BS02 CD A H118 C130 H113 C125
BS03 CD A H53 E57 H48 E52
BS04 GOL A K147 N150 K142 N145
BS05 GOL A F39 R56 F34 R51
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0008199 ferric iron binding
GO:0046872 metal ion binding
Biological Process
GO:0006826 iron ion transport
GO:0006879 intracellular iron ion homeostasis
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0031410 cytoplasmic vesicle
GO:0044754 autolysosome
GO:0070288 ferritin complex
GO:0071682 endocytic vesicle lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1lb3, PDBe:1lb3, PDBj:1lb3
PDBsum1lb3
PubMed12459904
UniProtP29391|FRIL1_MOUSE Ferritin light chain 1 (Gene Name=Ftl1)

[Back to BioLiP]