Structure of PDB 1l5y Chain A

Receptor sequence
>1l5yA (length=143) Species: 382 (Sinorhizobium meliloti) [Search protein sequence]
PSVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVIS
DIRMPGMDGLALFRKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIA
KPFAADRLVQSARRAEKKRRLVMENRSLRRAAEAASEGLKLAA
3D structure
PDB1l5y Two-component signaling in the AAA + ATPase DctD: binding Mg2+ and BeF3- selects between alternate dimeric states of the receiver domain
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A D12 D55 R57 D8 D51 R53
BS02 BEF A D55 I56 R57 T83 G84 H85 K105 D51 I52 R53 T79 G80 H81 K101
BS03 BF2 A I103 A104 R111 I99 A100 R107
BS04 BF2 A S6 T30 S2 T26
BS05 BF2 A R133 A139 S140 R129 A135 S136
BS06 BF2 A D87 I88 D83 I84
BS07 BF4 A R14 R17 A35 R10 R13 A31
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system

View graph for
Biological Process
External links
PDB RCSB:1l5y, PDBe:1l5y, PDBj:1l5y
PDBsum1l5y
PubMed12368235
UniProtP13632|DCTD_RHIME C4-dicarboxylate transport transcriptional regulatory protein DctD (Gene Name=dctD)

[Back to BioLiP]