Structure of PDB 1l5o Chain A

Receptor sequence

>1l5oA (length=346) Species: 28901 (Salmonella enterica)

LHALLRDIPAPDAEAMARTQQHIDGLLKPPGSLGRLETLAVQLAGMPGLN
GTPQVGEKAVLVMCADHGVWDEGVAVSPKIVTAIQAANMTRGTTGVCVLA
AQAGAKVHVIDVGIDAEPIPGVVNMRVARGCGNIAVGPAMSRLQAEALLL
EVSRYTCDLAQRGVTLFGVGELGMANTTPAAAMVSVFTGSDAKEVVGIGA
NLPPSRIDNKVDVVRRAIAINQPNPRDGIDVLSKVGGFDLVGMTGVMLGA
ARCGLPVLLDGFLSYSAALAACQIAPAVRPYLIPSHFSAEKGARIALAHL
SMEPYLHMAMRLGEGSGAALAMPIVEAACAMFHNMGELAASNIVLP

3D structure

• PDB: 1l5o Capture of a labile substrate by expulsion of water molecules from the active site of nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) from Salmonella enterica.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E174 E317
• Catalytic site (residue number reindexed from 1): E171 E314
• Enzyme Commision number: 2.4.2.21: nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2MP	A	V84 Q88 L315 E317	V81 Q85 L312 E314
BS02	NCN	A	E174 G176 M177 A178 N179 T180 G202 A203 F265 L266 S291 R314 L315 G316	E171 G173 M174 A175 N176 T177 G199 A200 F262 L263 S288 R311 L312 G313

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008939 nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity

Biological Process

• GO:0009236 cobalamin biosynthetic process

External links

• PDB: RCSB:1l5o, PDBe:1l5o, PDBj:1l5o
• PDBsum: 1l5o
• PubMed: 12101181
• UniProt: Q05603|COBT_SALTY Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (Gene Name=cobT)