Structure of PDB 1l3o Chain A

Receptor sequence
>1l3oA (length=68) Species: 891 (Desulfuromonas acetoxidans) [Search protein sequence]
ADVVTYENAAGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACK
TCHKSNNGPTKCGGCHIK
3D structure
PDB1l3o A quick solution structure determination of the fully oxidized double mutant K9-10A cytochrome c7 from Desulfuromonas acetoxidans and mechanistic implications.
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A Y6 H17 A21 C26 C29 H30 P34 A35 K36 I39 Y6 H17 A21 C26 C29 H30 P34 A35 K36 I39
BS02 HEC A V13 T14 F15 H20 C49 C52 H53 N56 C65 V13 T14 F15 H20 C49 C52 H53 N56 C65
BS03 HEC A N8 A9 A10 V13 D40 K41 A44 H45 C62 C65 H66 N8 A9 A10 V13 D40 K41 A44 H45 C62 C65 H66
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009061 anaerobic respiration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1l3o, PDBe:1l3o, PDBj:1l3o
PDBsum1l3o
PubMed11883773
UniProtP00137|CYC3_DESAC Cytochrome c3 (Gene Name=cyd)

[Back to BioLiP]