Structure of PDB 1l2d Chain A

Receptor sequence
>1l2dA (length=259) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence]
PELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQT
VRGLERRGKFLKFLLDRDALISHLRMEGRYAVASALEPLEPHTHVVFCFT
DGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAER
AVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIE
RLHEEMVATIGEAVMKGGSFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRG
THYCPRCQR
3D structure
PDB1l2d Structural insights into lesion recognition and repair by the bacterial 8-oxoguanine DNA glycosylase MutM.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A H93 V111 R112 F114 A262 H92 V110 R111 F113 A247
BS02 dna A E3 K60 H74 R76 M77 R112 Q166 G173 N174 I175 Y242 K258 R264 E2 K59 H73 R75 M76 R111 Q165 G172 N173 I174 Y227 K243 R249
BS03 ZN A C249 C252 C269 C272 C234 C237 C254 C257
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 16:26:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '1l2d', asym_id = 'A', title = 'Structural insights into lesion recognition and ... the bacterial 8-oxoguanine DNA glycosylase MutM.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='1l2d', asym_id='A', title='Structural insights into lesion recognition and ... the bacterial 8-oxoguanine DNA glycosylase MutM.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003676,0003677,0003684,0003906,0006281,0006284,0008270,0008534,0016799,0019104', uniprot = '', pdbid = '1l2d', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0003684,0003906,0006281,0006284,0008270,0008534,0016799,0019104', uniprot='', pdbid='1l2d', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>