Structure of PDB 1kyn Chain A

Receptor sequence

>1kynA (length=223) Species: 9606 (Homo sapiens) [Search protein sequence]

IIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNI
NVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDR
QCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKS
SGVPPEVFTRVSSFLPWIRTTMR

3D structure

PDB

1kyn Nonpeptide inhibitors of cathepsin G: optimization of a novel beta-ketophosphonic acid lead by structure-based drug design.

Chain

Resolution

3.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D102 K192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1)	H44 D88 K178 G179 D180 S181 G182
Enzyme Commision number	3.4.21.20: cathepsin G.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	KTP	A	H57 A190 F191 K192 S195 G216 K217	H44 A176 F177 K178 S181 G198 K199	PDBbind-CN: -logKd/Ki=5.39,IC50=4.1uM BindingDB: IC50=4100nM

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005515	protein binding
GO:0008201	heparin binding
GO:0008233	peptidase activity
GO:0008236	serine-type peptidase activity
GO:0048018	receptor ligand activity
GO:0089720	caspase binding

	Biological Process
GO:0002003	angiotensin maturation
GO:0002548	monocyte chemotaxis
GO:0006468	protein phosphorylation
GO:0006508	proteolysis
GO:0006935	chemotaxis
GO:0006955	immune response
GO:0016485	protein processing
GO:0019221	cytokine-mediated signaling pathway
GO:0019731	antibacterial humoral response
GO:0022617	extracellular matrix disassembly
GO:0030168	platelet activation
GO:0032496	response to lipopolysaccharide
GO:0035590	purinergic nucleotide receptor signaling pathway
GO:0042119	neutrophil activation
GO:0042742	defense response to bacterium
GO:0050778	positive regulation of immune response
GO:0050829	defense response to Gram-negative bacterium
GO:0050830	defense response to Gram-positive bacterium
GO:0050832	defense response to fungus
GO:0050868	negative regulation of T cell activation
GO:0070946	neutrophil-mediated killing of gram-positive bacterium
GO:0071222	cellular response to lipopolysaccharide
GO:0098786	biofilm matrix disassembly
GO:1901731	positive regulation of platelet aggregation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0010494	cytoplasmic stress granule
GO:0016020	membrane
GO:0030141	secretory granule
GO:0035578	azurophil granule lumen
GO:0043231	intracellular membrane-bounded organelle
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1kyn, PDBe:1kyn, PDBj:1kyn
PDBsum	1kyn
PubMed	11942800
UniProt	P08311\|CATG_HUMAN Cathepsin G (Gene Name=CTSG)

[Back to BioLiP]