Structure of PDB 1kvj Chain A |
>1kvjA (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] |
MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATI IYDPKLQTPKTLQEAIDDMGFDAVIHNPD |
|
PDB | 1kvj Solution structures of the reduced and Cu(I) bound forms of the first metal binding sequence of ATP7A associated with Menkes disease. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
7.2.2.8: P-type Cu(+) transporter. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
C19 S21 C22 |
C19 S21 C22 |
|
|
|
|