Structure of PDB 1kuq Chain A

Receptor sequence
>1kuqA (length=84) Species: 274 (Thermus thermophilus) [Search protein sequence]
CKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSH
RGLLMMVGQRRRLLRYLQREDPERYRALIEKLGI
3D structure
PDB1kuq Role of N-terminal helix in interaction of ribosomal protein S15 with 16S rRNA.
ChainA
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A K7 Q8 F17 T21 G22 S23 Q27 L30 L38 H41 V44 H45 K47 D48 H50 S51 G54 R64 Y68 K5 Q6 F15 T19 G20 S21 Q25 L28 L36 H39 V42 H43 K45 D46 H48 S49 G52 R62 Y66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kuq, PDBe:1kuq, PDBj:1kuq
PDBsum1kuq
PubMed15627386
UniProtP80378|RS15_THETH Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]